PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G055700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 748aa    MW: 82050.1 Da    PI: 5.9876
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G055700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-155195147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+ E++++++a k++G   W +I +++g ++t+ q++s+ qk+
  Seita.6G055700.1.p 51 RERWTEAEHKRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 95
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1645101IPR009057Homeodomain-like
PROSITE profilePS5129419.14746100IPR017930Myb domain
TIGRFAMsTIGR015571.7E-164998IPR006447Myb domain, plants
SMARTSM007176.5E-125098IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-85191IPR009057Homeodomain-like
PfamPF002491.5E-125194IPR001005SANT/Myb domain
CDDcd001671.09E-85396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MTSTPSDQAS SCWTIPFYFC FFFLDLEMEV NSSGEETVVK VRKPYTITKQ RERWTEAEHK  60
RFLEALKLYG RAWQRIEEHV GTKTAVQIRS HAQKFFTKLE KEAMNNGTSP GQAHDIDIPP  120
PRPKRKPNSP YPRKNGLSSE TPTKELPNDK SSKSNITLSS GNVQMVGDMS LQKFQRKEVS  180
EKGSCSEVLN LFRDAPSASF SSVNKSSSNN GVPRGVEPTK TEIRDMTTTE KNSINPTMEE  240
DVKEIDVPEI GRVNGIHVSS KCDYSNEEYL DFSMQQMKLK PKSSETTYVD KQTARTSHSL  300
AERNGATSIP VTGTDGTRPD QTGDQVGVNG SMNPCIHPML STDPKFDSSA TPQPFPHNYA  360
AFAPMMQCNC NQDTYRSFVN MSSTFSSMLV STLLSNPAIH AAARLAASYW PAAEGNTPVD  420
PTQENPAEGV QGRNLGSPPS MASIVAATVA AASAWWATQG LLPFFTPPMA FPFVPAPSAA  480
FTTADVPRPL DKDRDSPVEN AQKGCQEAQK QGQSEALRVA VSSESDGTRK GDMSLHTELK  540
ISPVQNTDAA PTTGADISDA FRNKKKQDRS SCGSNTPSSS DVEAGNVPEK EDKANDKAKQ  600
ASCSNSSAGD TNHRKFRSSG STSDSWKEVS EEGRMAFDAL FSREKLPQSF SPPQAEESKE  660
VAKEEEDEVT TVTVDLNKNA TTIDHDLDMM DEPRTSFPNE LSHLKLKSRK TGFKPYKRCS  720
VEAKENRVPA SDEVGTKRIR LESEEST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702452.10.0PREDICTED: protein LHY
RefseqXP_012702451.10.0PREDICTED: protein LHY
RefseqXP_012702450.10.0PREDICTED: protein LHY
RefseqXP_004972798.10.0PREDICTED: protein LHY
RefseqXP_012702449.10.0PREDICTED: protein LHY
RefseqXP_004972799.10.0PREDICTED: protein LHY
RefseqXP_012702448.10.0PREDICTED: protein LHY
SwissprotQ6R0H11e-43LHY_ARATH; Protein LHY
TrEMBLK3YGN00.0K3YGN0_SETIT; Uncharacterized protein
STRINGSi013398m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60313447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-40circadian clock associated 1